PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do011673.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 256aa    MW: 27204.4 Da    PI: 6.4046
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do011673.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.13e-11127174552
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                 kr +r   NR +A+rsR RK+++i eLe+ v +L+ e +aL  ++  l
  Do011673.1 127 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQMEVSALSPRVAFL 174
                 899**********************************99998776555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-13123187IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.634125181IPR004827Basic-leucine zipper domain
PfamPF001701.2E-9127176IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.3E-12127181No hitNo description
SuperFamilySSF579591.62E-11127181No hitNo description
CDDcd147034.89E-21128178No hitNo description
PROSITE patternPS000360130145IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MAQLPPRAPS AGAQDHWSAA GEFLGFAAAR RGAHRRSASD SAAFLEAVPM DDVIGGGAGG  60
DDFDRLDDEQ LMSMFSDVDT QAVSDGAGGG DRAGDAQLMD MGDAEDGMAA SSPAGARAAA  120
DGVADPKRVK RILANRQSAQ RSRVRKLQYI SELERSVTSL QMEVSALSPR VAFLDHQRSL  180
LTVGNSHLKQ RIAALAQDKI FKDAHQEALK KEIERLRQLF HHQQIKGATT GGADIATAAS  240
MQARQELLAC EGAAIR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451860.11e-147hypothetical protein SORBIDRAFT_04g008840
SwissprotQ6K3R91e-110BZP19_ORYSJ; Basic leucine zipper 19
TrEMBLA0A0A9FPX71e-164A0A0A9FPX7_ARUDO; Uncharacterized protein
STRINGSb04g008840.11e-147(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.19e-54bZIP family protein